PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe3G285000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family MYB
Protein Properties Length: 416aa    MW: 47253 Da    PI: 6.7367
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe3G285000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding63.93e-20190236148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        +g+WT eEd +lv++v+++G ++W++++++mg gR +kqc++rw ++l
  Aqcoe3G285000.1.p 190 KGNWTHEEDRKLVRLVEKHGEKNWAKVSSCMG-GRIGKQCRDRWKNHL 236
                        79******************************.*************97 PP

2Myb_DNA-binding57.63e-18242286147
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        +g WT++Ed  lv+++k++ ++ W++Ia++++ gRt++ +k+rw+++
  Aqcoe3G285000.1.p 242 KGCWTEDEDMALVEGHKKHNNR-WAKIAEEIP-GRTDNAVKNRWNSV 286
                        799*******************.*********.***********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.492185240IPR017930Myb domain
SuperFamilySSF466892.49E-31187283IPR009057Homeodomain-like
SMARTSM007174.0E-19189238IPR001005SANT/Myb domain
PfamPF002496.0E-19190236IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.0E-25191244IPR009057Homeodomain-like
CDDcd001671.18E-17192236No hitNo description
SMARTSM007176.2E-18241289IPR001005SANT/Myb domain
PROSITE profilePS5129421.727241291IPR017930Myb domain
PfamPF002499.9E-17242286IPR001005SANT/Myb domain
CDDcd001678.92E-15245287No hitNo description
Gene3DG3DSA:1.10.10.601.1E-20245289IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 416 aa     Download sequence    Send to blast
MAYQNMYTNE VSYQLPTLSL RRPMNQIRPM VGSEFSFDEV KSSQGGLFQD FRYVNQYHSN  60
GKILKSDYDI SILSFVRLNI FVYGNSNRDL VGSMSVVRKG DTNEIQYENY SDSLRSFENK  120
ATTQDQNQMF LDLPKNDVHA HVGTCFGFSN MFPCVTTDNQ FVGEVSQIKK SGTHKRKNNE  180
AFKESFGSIK GNWTHEEDRK LVRLVEKHGE KNWAKVSSCM GGRIGKQCRD RWKNHLEPGI  240
NKGCWTEDED MALVEGHKKH NNRWAKIAEE IPGRTDNAVK NRWNSVKRRQ SPKEKKYCHS  300
KNPLPSPILQ EYINSVSNKS TGSTNKVGNA ATSDCYIPMD DTLAVPIAPA DQGGEFVALP  360
SLPFNFDVSI FEEEMFSILN EGITDNVMPS DVDHLNPYSV NKEMDLFEMI SEANI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C3e-381892903104C-Myb DNA-Binding Domain
1mse_C3e-381892903104C-Myb DNA-Binding Domain
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.18e-45myb domain protein 98